Iright
BRAND / VENDOR: Proteintech

Proteintech, 11028-2-AP, FHL3 Polyclonal antibody

CATALOG NUMBER: 11028-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FHL3 (11028-2-AP) by Proteintech is a Polyclonal antibody targeting FHL3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11028-2-AP targets FHL3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, mouse ovary tissue Positive IP detected in: K-562 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Four and a half LIM domain (FHL) protein 3 is a member of the FHL protein family that has roles in the regulation of signal transduction, survival, cell adhesion, and mobility. It also involves in the development and progression of liver cancer. The FHL proteins have been shown to regulate a variety of transcription factors, including SMAD proteins, β-catenin, SRF, AP-1, NFAT, FOXO1, MyoD, and the androgen receptor. Beside, the FHL proteins may involve in muscle growth and differentiation. Recent research revealed FHL3 was a PCBP2 target, also involved in the growth and induced apoptosis of glioma cell (23585479). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1495 Product name: Recombinant human FHL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC011697 Sequence: MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP Predict reactive species Full Name: four and a half LIM domains 3 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31-34 kDa GenBank Accession Number: BC011697 Gene Symbol: FHL3 Gene ID (NCBI): 2275 RRID: AB_2294066 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13643 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924