Iright
BRAND / VENDOR: Proteintech

Proteintech, 11064-1-AP, SOX2 Polyclonal antibody

CATALOG NUMBER: 11064-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SOX2 (11064-1-AP) by Proteintech is a Polyclonal antibody targeting SOX2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, zebrafish samples 11064-1-AP targets SOX2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human lung cancer tissue, human cervical squamous cancer tissue, human gliomas tissue, mouse brain tissue, mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human embronic stem cells, mouse embryo tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:200 Immunofluorescence (IF)-P: IF-P : 1:10-1:100 Background Information BackgroundSRY (sex determining region Y)-box 2 is a transcription factor involved in neural stem cell maintenance and has been used in somatic cell reprogramming.What is the molecular weight of Sox2?34 kDa. Sox2 is an intronless gene encoding xx amino acids including HMG (High-mobility group) box domains that can bind to DNA.What is the tissue specificity of Sox2?In embryonic stem cells, Sox2 is highly expressed and is essential in self-renewal. In the developing embryo, Sox2 is found in the neural tube and then in the developing eye and central nervous system (CNS). This expression is highly conserved across organisms (PMID: 25126380; PMID: 8625802).In adult tissues Sox2 is expressed in neural progenitor cells, which as multipotent cells can both self-renew and differentiate into neurons, astroglia, and oligodendroglia. It maintains their stem cell phenotype and is a useful marker of early neural stem cells (PMID: 16139372).What is the role of Sox2 in pluripotency?Sox2 acts as part of the LIF (Leukemia inhibitory factor) pathway, activated via JAK-STAT signaling to form complexes with other transcription factors such as Oct4 that bind to DNA and work to control pluripotency. Sox2 was described as one of the four original factors that are key to the reprogramming of somatic cells to induced pluripotent stem cells (iPSCs) (PMID: 16904174).What is the role of Sox2 in cancer?The ability to control pluripotency means dysregulation of Sox2 can lead to uncontrolled proliferation. In many different cancers, Sox2 has been associated with the metastasis and growth of tumors, mostly due to overexpression (PMID: 28388544). The increased levels of Sox2 RNA and protein in tumor tissue highlight it as a potential therapeutic target (PMID: 25114775). Specification Tested Reactivity: human, mouse, rat, zebrafish Cited Reactivity: human, mouse, rat, pig, hamster, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1530 Product name: Recombinant human SOX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 59-118 aa of BC013923 Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT Predict reactive species Full Name: SRY (sex determining region Y)-box 2 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34-40 kDa GenBank Accession Number: BC013923 Gene Symbol: SOX2 Gene ID (NCBI): 6657 RRID: AB_2195801 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48431 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924