Iright
BRAND / VENDOR: Proteintech

Proteintech, 11080-1-AP, UBE2A Polyclonal antibody

CATALOG NUMBER: 11080-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UBE2A (11080-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2A in WB, IHC, ELISA applications with reactivity to human samples 11080-1-AP targets UBE2A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, COLO 320 cells, human kidney tissue, human placenta tissue Positive IHC detected in: human nasopharyngeal carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UBE2A(Ubiquitin-conjugating enzyme E2 A) serves as the cognate E2-conjugating enzyme. It plays a critical role in regulating TP53 protein levels under both normal and stress conditions. UBE2A, UBE2B regulates TP53 levels in a "yin-yang" manner through a combination of two distinct mechanisms in mammalian cells(PMID:22083959). This protein has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1567 Product name: Recombinant human UBE2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-152 aa of BC010175 Sequence: AGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC Predict reactive species Full Name: ubiquitin-conjugating enzyme E2A (RAD6 homolog) Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC010175 Gene Symbol: UBE2A Gene ID (NCBI): 7319 RRID: AB_2212040 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49459 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924