Iright
BRAND / VENDOR: Proteintech

Proteintech, 11087-2-AP, IRSp53 Polyclonal antibody

CATALOG NUMBER: 11087-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IRSp53 (11087-2-AP) by Proteintech is a Polyclonal antibody targeting IRSp53 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 11087-2-AP targets IRSp53 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissue, human brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information IRSp53 (also known as BAIAP2) is a multi-domain adaptor protein that originally identified as a 58/53-kDa substrate of insulin-receptor kinase in the hamster (PMID: 10332026). As a BAI1-binding protein, IRSp53 plays an important role in linking between membrane and cytoskeleton in the process of neuronal growth (PMID: 10343108). IRSp53 is necessary for Cdc42-mediated reorganization of the actin cytoskeleton and for Rac1-mediated membrane ruffling. Alternatively spliced isoforms of IRSp53 exist. IRSp53 has been implicated in several psychiatric disorders, including autism spectrum disorders (ASDs), schizophrenia, and attention deficit/hyperactivity disorder (ADHD) (PMID: 26275848). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1552 Product name: Recombinant human BAIAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC014020 Sequence: MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN Predict reactive species Full Name: BAI1-associated protein 2 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC014020 Gene Symbol: IRSp53 Gene ID (NCBI): 10458 RRID: AB_2063075 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQB8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924