Iright
BRAND / VENDOR: Proteintech

Proteintech, 11103-1-AP, GATA2 Polyclonal antibody

CATALOG NUMBER: 11103-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GATA2 (11103-1-AP) by Proteintech is a Polyclonal antibody targeting GATA2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11103-1-AP targets GATA2 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse liver tissue, K-562 cells, mouse heart tissue, rat heart tissue, HEK-293 cells, rat liver tissue Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information What is the molecular weight of GATA2? Is GATA2 post-translationally modified?The molecular weight of GATA2 is 51 kDa. There are two known isoforms of GATA2 that use alternative first exons (PMID: 10731672). GATA2 can be phosphorylated, which regulates its activity (PMID: 7876160).What is the subcellular localization of GATA2?GATA2 acts as a transcription factor in the nucleus. However, it can also be found in the cytoplasm (PMID: 25163535) and its phosphorylation promotes nuclear localization (PMID: 15837948).What is the tissue expression pattern of GATA2?GATA2 was initially identified as a hematopoietic transcription factor regulating the differentiation of hematopoietic stem cells but is also present in early erythroid cells, mast cells, and megakaryocytes. Additionally, it is expressed in the central nervous system (PMID: 10357893). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1557 Product name: Recombinant human GATA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 168-467 aa of BC018988 Sequence: SHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG Predict reactive species Full Name: GATA binding protein 2 Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC018988 Gene Symbol: GATA2 Gene ID (NCBI): 2624 ENSEMBL Gene ID: ENSG00000179348 RRID: AB_10914503 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23769 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924