Proteintech, 11108-1-AP, ACVR1 Polyclonal antibody

Size: 20ul / 150ul The ACVR1 (11108-1-AP) by Proteintech is a Polyclonal antibody targeting ACVR1 in WB, ELISA applications with reactivity to human, mouse, rat samples 11108-1-AP targets ACVR1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1556 Product name: Recombinant human ACVR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-509 aa of BC033867 Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC Predict reactive species Full Name: activin A receptor, type I Calculated Molecular Weight: 509 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC033867 Gene Symbol: ACVR1 Gene ID (NCBI): 90 RRID: AB_3085368 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q04771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.