Iright
BRAND / VENDOR: Proteintech

Proteintech, 11110-1-AP, CYLD Polyclonal antibody

CATALOG NUMBER: 11110-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CYLD (11110-1-AP) by Proteintech is a Polyclonal antibody targeting CYLD in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11110-1-AP targets CYLD in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HEK-293 cells, A431 cells, Jurkat cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human colon cancer tissue, human brain tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CYLD, also named as CYLD1, belongs to the peptidase C67 family. It is the protease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. CYLD has endodeubiquitinase activity and plays an important role in the regulation of pathways leading to NF-kappa-B activation. CYLD contributes to the regulation of cell survival, proliferation and differentiation via its effects on NF-kappa-B activation. It is a negative regulator of Wnt signaling. CYLD inhibits HDAC6 and thereby promotes acetylation of alpha-tubulin and stabilization of microtubules. CYLD plays a role in the regulation of microtubule dynamics, and thereby contributes to the regulation of cell proliferation, cell polarization, cell migration, and angiogenesis. It is required for normal cell cycle progress and normal cytokinesis. CYLD inhibits nuclear translocation of NF-kappa-B and plays a role in the regulation of inflammation and the innate immune response, via its effects on NF-kappa-B activation. It is dispensable for the maturation of intrathymic natural killer cells, but required for the continued survival of immature natural killer cells. CYLD negatively regulates TNFRSF11A signaling and osteoclastogenesis. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human CYLD. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1598 Product name: Recombinant human CYLD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 654-953 aa of BC012342 Sequence: TKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK Predict reactive species Full Name: cylindromatosis (turban tumor syndrome) Calculated Molecular Weight: 107 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC012342 Gene Symbol: CYLD Gene ID (NCBI): 1540 RRID: AB_10915966 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924