Iright
BRAND / VENDOR: Proteintech

Proteintech, 11137-1-AP, MMAB Polyclonal antibody

CATALOG NUMBER: 11137-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MMAB (11137-1-AP) by Proteintech is a Polyclonal antibody targeting MMAB in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11137-1-AP targets MMAB in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, BxPC-3 cells, HepG2 cells, L02 cells Positive IP detected in: HeLa cells Positive IHC detected in: human ovarian cancer, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The MMAB gene encodes cob(I)alamin adenosyltransferase, which catalyzes the final step in the synthesis of the coenzyme adenosylcobalamin (AdoCbl). AdoCbl is a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. The deduced 250-amino acid protein has a calculated molecular mass of 27.3 kD. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1602 Product name: Recombinant human MMAB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC011831 Sequence: MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL Predict reactive species Full Name: methylmalonic aciduria (cobalamin deficiency) cblB type Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC011831 Gene Symbol: MMAB Gene ID (NCBI): 326625 RRID: AB_2235498 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EY8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924