Proteintech, 11179-1-AP, TIMM8A Polyclonal antibody

Size: 20ul / 150ul The TIMM8A (11179-1-AP) by Proteintech is a Polyclonal antibody targeting TIMM8A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11179-1-AP targets TIMM8A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TIMM8A (translocase of inner mitochondrial membrane 8A) is a mitochondrial intermembrane space chaperone that forms a 70 kDa hetero-hexamer with TIMM13 and escorts hydrophobic inner-membrane proteins from the cytosol into mitochondria. It acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins. Probably necessary for normal neurologic development. (PMID: 11489896; 15254020) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1661 Product name: Recombinant human TIMM8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC015093 Sequence: MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD Predict reactive species Full Name: translocase of inner mitochondrial membrane 8 homolog A (yeast) Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC015093 Gene Symbol: TIMM8A Gene ID (NCBI): 1678 RRID: AB_2204687 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60220 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.