Proteintech, 11193-1-AP, EIF1AY Polyclonal antibody

Size: 20ul / 150ul The EIF1AY (11193-1-AP) by Proteintech is a Polyclonal antibody targeting EIF1AY in WB, IF/ICC, ELISA applications with reactivity to human samples 11193-1-AP targets EIF1AY in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF7 cells, MCF-7 cells, HEK-293 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information EIF1AY is 1 of 5 NRY genes that are expressed in many tissues and have homologs on the X chromosome, which is an essential translation initiation factor. EIF1AY seems to be required for maximal rate of protein biosynthesis, and enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits. This is a rabbit polyclonal antibody raised against the full length of human EIF1AY, and can recognize both EIF1AY and EIF1AX. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1680 Product name: Recombinant human EIF1AY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC005248 Sequence: MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI Predict reactive species Full Name: eukaryotic translation initiation factor 1A, Y-linked Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16-20 kDa GenBank Accession Number: BC005248 Gene Symbol: EIF1AY Gene ID (NCBI): 9086 RRID: AB_2262159 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14602 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.