Iright
BRAND / VENDOR: Proteintech

Proteintech, 11196-1-AP, PSMC1 Polyclonal antibody

CATALOG NUMBER: 11196-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PSMC1 (11196-1-AP) by Proteintech is a Polyclonal antibody targeting PSMC1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11196-1-AP targets PSMC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells, A549 cells, HeLa cells, mouse lung tissue, Jurkat cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PSMC1(26S protease regulatory subunit 4) is also named as p26s4 and belongs to the AAA ATPase family.The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1677 Product name: Recombinant human PSMC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 77-440 aa of BC016368 Sequence: EFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNRAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, ATPase, 1 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 52-57 kDa GenBank Accession Number: BC016368 Gene Symbol: PSMC1 Gene ID (NCBI): 5700 RRID: AB_2284521 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62191 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924