Iright
BRAND / VENDOR: Proteintech

Proteintech, 11203-1-AP, TXNL6 Polyclonal antibody

CATALOG NUMBER: 11203-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TXNL6 (11203-1-AP) by Proteintech is a Polyclonal antibody targeting TXNL6 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 11203-1-AP targets TXNL6 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TXNL6, also named as NXNL1, belongs to the nucleoredoxin family. It may play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods. TXNL6 is a Novel Oxidative Stress-Induced Reducing System for Methionine Sulfoxide Reductase A Repair of a-Crystallin and Cytochrome C in the Eye Lens. It serve as a reducing system for MsrA repair of the essential lens chaperone a-crystallin/sHSP and mitochondrial cytochrome c. TXNL6 is induced at high levels in human lens epithelial cells exposed to H2O2-induced oxidative stress.(PMID:21079812) Specification Tested Reactivity: human, mouse Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1691 Product name: Recombinant human TXNL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC014127 Sequence: MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF Predict reactive species Full Name: nucleoredoxin-like 1 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 26-28 kDa GenBank Accession Number: BC014127 Gene Symbol: NXNL1 Gene ID (NCBI): 115861 RRID: AB_2158126 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924