Iright
BRAND / VENDOR: Proteintech

Proteintech, 11218-1-AP, TCEAL7 Polyclonal antibody

CATALOG NUMBER: 11218-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TCEAL7 (11218-1-AP) by Proteintech is a Polyclonal antibody targeting TCEAL7 in WB, IHC, ELISA applications with reactivity to human samples 11218-1-AP targets TCEAL7 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human liver tissue, A549 cells Positive IHC detected in: human ovary tumor tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TCEAL7 is a transcription regulatory factor that has a role in the negative regulation of NF-kappa-B signaling at the basal level by regulating transcriptional activity of NF-kappa-B on its target gene promoters. It can associate with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. In addition, TCEAL7 regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1715 Product name: Recombinant human TCEAL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC016786 Sequence: MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI Predict reactive species Full Name: transcription elongation factor A (SII)-like 7 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC016786 Gene Symbol: TCEAL7 Gene ID (NCBI): 56849 RRID: AB_2201131 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924