Iright
BRAND / VENDOR: Proteintech

Proteintech, 11232-2-AP, AEBP2 Polyclonal antibody

CATALOG NUMBER: 11232-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AEBP2 (11232-2-AP) by Proteintech is a Polyclonal antibody targeting AEBP2 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 11232-2-AP targets AEBP2 in WB, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information AEBP2, also named as Zinc finger protein AEBP2 or Adipocyte enhancer-binding protein 2, is a 517 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the AEBP2/jing C2H2-type zinc-finger family. AEBP2 as a DNA-binding transcriptional repressor may interact with and stimulate the activity of the PRC2 complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3. It may e playing a role in craniofacial and digital development, as well as development of the central nervous system and gastrointestinal tract. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1756 Product name: Recombinant human AEBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC015624 Sequence: MSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR Predict reactive species Full Name: AE binding protein 2 Calculated Molecular Weight: 33 kDa, 54 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC015624 Gene Symbol: AEBP2 Gene ID (NCBI): 121536 RRID: AB_2225962 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZN18 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924