Iright
BRAND / VENDOR: Proteintech

Proteintech, 11243-1-AP, ARHGEF18 Polyclonal antibody

CATALOG NUMBER: 11243-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARHGEF18 (11243-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGEF18 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 11243-1-AP targets ARHGEF18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: mouse kidney tissue, human kidney tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1749 Product name: Recombinant human ARHGEF18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC014994 Sequence: MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG Predict reactive species Full Name: rho/rac guanine nucleotide exchange factor (GEF) 18 Calculated Molecular Weight: 131 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC014994 Gene Symbol: ARHGEF18 Gene ID (NCBI): 23370 RRID: AB_2877753 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZSZ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924