Iright
BRAND / VENDOR: Proteintech

Proteintech, 11289-1-AP, PARP3 Polyclonal antibody

CATALOG NUMBER: 11289-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PARP3 (11289-1-AP) by Proteintech is a Polyclonal antibody targeting PARP3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11289-1-AP targets PARP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, human heart tissue, human kidney tissue, rat heart tissue, mouse kidney tissue Positive IHC detected in: human breast cancer tissue, human pancreas cancer tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information PARP3 (Poly(ADP-ribose) polymerase 3), also known as ARTD3, is the third member of the PARP family that catalyze a post-translational modification of proteins to promote, control or adjust numerous cellular events including genome integrity, transcription, differentiation, cell metabolism or cell death (PMID: 31095444). PARP3 is a 60-kDa protein containing an N-terminal WGR (tryptophan-, glycine-, and arginine-rich) domain and a C-terminal catalytic domain. PARP3 has been described to interact with partners belonging to the NHEJ pathway including DNA-PKcs, DNA ligase IV, Ku70 and Ku80 and to accelerate XRCC4/DNA ligase IV-mediated ligation of chromosomal DSB in concert with APLF (PMID: 24598253). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1844 Product name: Recombinant human PARP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-533 aa of BC014260 Sequence: EALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL Predict reactive species Full Name: poly (ADP-ribose) polymerase family, member 3 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60-62 kDa GenBank Accession Number: BC014260 Gene Symbol: PARP3 Gene ID (NCBI): 10039 RRID: AB_2283392 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6F1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924