Iright
BRAND / VENDOR: Proteintech

Proteintech, 11327-1-AP, ATRIP Polyclonal antibody

CATALOG NUMBER: 11327-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATRIP (11327-1-AP) by Proteintech is a Polyclonal antibody targeting ATRIP in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 11327-1-AP targets ATRIP in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, PC-3 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ATRIP (ATR Interacting Protein) and ATR signalling complex is a central mediator of the replicative stress response (RSR),and mutations in both genes have been reported in Seckel syndrome. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1869 Product name: Recombinant human ATRIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 464-765 aa of BC014153 Sequence: PEDSVCILEGFSVTALSILQHLVCHSGAVVSLLLSGVGADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLKMLLHLLAFSSAATGHLQASVLTQCLKVLVKLAENTSCDFLPRFQCVFQVLPKCLSPETPLPSVLLAVELLSLLADHDQLAPQLCSHSEGCLLLLLYMYITSRPDRVALETQWLQLEQEVVRALTVMLHRQWLTVRRAGGPPRTDQQRRTVRCLRDTVLLLHGLSQKDKLFMMHCVEVLHQFDQVMPGVSMLIRGLPDVTDCEEAALDDLCAAETDVEDPEVECG Predict reactive species Full Name: ATR interacting protein Calculated Molecular Weight: 791 aa, 86 kDa Observed Molecular Weight: 86-90 kDa GenBank Accession Number: BC014153 Gene Symbol: ATRIP Gene ID (NCBI): 84126 RRID: AB_10837229 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXE1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924