Proteintech, 11338-1-AP, SUV39H2 Polyclonal antibody

Size: 20ul / 150ul The SUV39H2 (11338-1-AP) by Proteintech is a Polyclonal antibody targeting SUV39H2 in WB, ELISA applications with reactivity to human, mouse, rat samples 11338-1-AP targets SUV39H2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1882 Product name: Recombinant human SUV39H2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-350 aa of BC007754 Sequence: VKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN Predict reactive species Full Name: suppressor of variegation 3-9 homolog 2 (Drosophila) Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC007754 Gene Symbol: SUV39H2 Gene ID (NCBI): 79723 RRID: AB_2196730 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H5I1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.