Iright
BRAND / VENDOR: Proteintech

Proteintech, 11341-1-AP, ZBTB7B Polyclonal antibody

CATALOG NUMBER: 11341-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZBTB7B (11341-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB7B in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11341-1-AP targets ZBTB7B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:800-1:3200 Background Information ZBTB7B belongs to a large family of transcription factors, generally acting as repressors, characterized by a carboxy-terminal DNA binding domain made of multiple zinc fingers (four in Thpok) and an amino-terminal BTB-POZ domain that mediates homo- (and possibly hetero-) dimerization [PMID: 17084908]. Zbtb7b is up-regulated by MHC-II-restricted thymocytes during their CD4 differentiation and is a major determinant of CD4 lineage choice. Two properties of ZBTB7B deserve attention. First, although Thpok is expressed in a wide variety of cells, its expression in the thymus is highly lineage-specific : CD4 SP thymocytes (and all CD4 T cells) express Thpok, whereas DP and CD8 SP thymocytes do notSecond, both loss- and gain-of-function experiments indicate that Thpok affects lineage choice but not positive selection [PMID: 15729333, 10550051]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, bovine, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1888 Product name: Recombinant human ZBTB7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC012070 Sequence: MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFKKLFTEGGGGAVMGAGGSGTATGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSP Predict reactive species Full Name: zinc finger and BTB domain containing 7B Calculated Molecular Weight: 539 aa, 58 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC012070 Gene Symbol: ZBTB7B Gene ID (NCBI): 51043 RRID: AB_2217245 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15156 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924