Proteintech, 11343-1-AP, FGFR1OP Polyclonal antibody

Size: 20ul / 150ul The FGFR1OP (11343-1-AP) by Proteintech is a Polyclonal antibody targeting FGFR1OP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11343-1-AP targets FGFR1OP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse heart tissue, U-937 cells, HL-60 cells, MCF-7 cells, HeLa cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The fibroblast growth factor receptor 1 oncogene partner (FGFR1OP), FOP, is a centrosomal protein that is involved in the anchoring of microtubules to subcellular structures. Three isoforms have been produced by alternative splicing. A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma and progresses to acute myeloid leukemia. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1891 Product name: Recombinant human FGFR1OP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-374 aa of BC011902 Sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADY Predict reactive species Full Name: FGFR1 oncogene partner Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC011902 Gene Symbol: FGFR1OP Gene ID (NCBI): 11116 RRID: AB_2103362 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95684 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.