Proteintech, 11374-1-AP, ZNF266 Polyclonal antibody

Size: 20ul / 150ul The ZNF266 (11374-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF266 in WB, IHC, ELISA applications with reactivity to human samples 11374-1-AP targets ZNF266 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ZNF266, also named as HZF1, was expressed in ubiquitous tissues and various hematopoietic cell lines. Expression of ZNF266 in K562 cells was increased after being induced by hemin or phorbol myristate acetate (PMA), suggesting that HZF1 play important roles in erythroid and megakaryocytic differentiation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1933 Product name: Recombinant human ZNF266 protein Source: e coli. -derived, PKG Tag: GST Domain: 31-293 aa of BC017407 Sequence: MKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIHTGIKPYKCKDCGKAFTQNSDLTKHARTHSGERPYECKECGKAFARSSRLSEHTRTHTGEKPFECVKCGKAFAISSNLSGHLRIHTGEKPFECLECGKAFTHSSSLNNHMRTHSAKKPFTCMECGKAFKFPTCVNLHMRIHTGEKPYKCKQCGKSFSYSNSFQLHERTHTGEKPYECKECGKAFSSSSSFRNHERRHADERLSA Predict reactive species Full Name: zinc finger protein 266 Calculated Molecular Weight: 670 aa, 70 kDa Observed Molecular Weight: 50-55 kDa, 70-75 kDa GenBank Accession Number: BC017407 Gene Symbol: ZNF266 Gene ID (NCBI): 10781 RRID: AB_2257588 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.