Proteintech, 11376-1-AP, SULT1A4 Polyclonal antibody

Size: 20ul / 150ul The SULT1A4 (11376-1-AP) by Proteintech is a Polyclonal antibody targeting SULT1A4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 11376-1-AP targets SULT1A4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human colon tissue, BxPC-3 cells, HepG2 cells, human pancreas tissue, mouse pancreas tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1935 Product name: Recombinant human SULT1A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC014471 Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Predict reactive species Full Name: sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 Calculated Molecular Weight: 295 aa, 34 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC014471 Gene Symbol: SULT1A4 Gene ID (NCBI): 445329 RRID: AB_2197610 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0DMN0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.