Iright
BRAND / VENDOR: Proteintech

Proteintech, 11382-2-AP, EHD4 Polyclonal antibody

CATALOG NUMBER: 11382-2-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EHD4 (11382-2-AP) by Proteintech is a Polyclonal antibody targeting EHD4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11382-2-AP targets EHD4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse testis tissue, HeLa cells, HEK-293T cells, HepG2 cells, mouse heart tissue, rat heart tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information H-domain containing 4, also known as EHD4, belongs to the EHD protein family. Northern blot analysis detected expression of 4 mRNA species of approximately 2.0, 2.7, 3.2, and 3.6 kb. All of the transcripts are highly expressed in pancreas, and the 2.7- and 3.6-kb transcripts are highly expressed in heart. Only weak expression is found in other tissues. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1942 Product name: Recombinant human EHD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 335-541 aa of BC006287 Sequence: ISRLPEIYIQLQREYQISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKAD Predict reactive species Full Name: EH-domain containing 4 Calculated Molecular Weight: 541 aa, 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC006287 Gene Symbol: EHD4 Gene ID (NCBI): 30844 RRID: AB_2277764 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H223 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924