Iright
BRAND / VENDOR: Proteintech

Proteintech, 11388-1-AP, CHRNA6 Polyclonal antibody

CATALOG NUMBER: 11388-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHRNA6 (11388-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNA6 in WB, ELISA applications with reactivity to human, mouse, rat samples 11388-1-AP targets CHRNA6 in WB, FC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1921 Product name: Recombinant human CHRNA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC014456 Sequence: MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIP Predict reactive species Full Name: cholinergic receptor, nicotinic, alpha 6 Calculated Molecular Weight: 494 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC014456 Gene Symbol: CHRNA6 Gene ID (NCBI): 8973 RRID: AB_2080683 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15825 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924