Proteintech, 11402-1-AP, EEF1A1 Polyclonal antibody

Size: 20ul / 150ul The EEF1A1 (11402-1-AP) by Proteintech is a Polyclonal antibody targeting EEF1A1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11402-1-AP targets EEF1A1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, mouse liver tissue, mouse skeletal muscle tissue, MCF-7 cells, mouse pancreas tissue, mouse ovary tissue, mouse heart tissue, rat brain tissue, human brain tissue, Jurkat cells, SH-SY5Y cells, Neuro-2a cells, C2C12 cells, HepG2 cells, mouse brain tissue Positive IHC detected in: mouse brain tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information EEF1A1, also named as EEF1A, EF1A and LENG7, belongs to the GTP-binding elongation factor family. This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. It is a typical housekeeping gene product required for the maintenance of cell growth and/or survival. In addition, EEF1A1 protects the aminoester bond against hydrolysis until a correct match between the codon on mRNA and the anti-codon on tRNA can be achieved. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human EEF1A1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1938 Product name: Recombinant human EEF1A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-462 aa of BC014224 Sequence: GVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK Predict reactive species Full Name: eukaryotic translation elongation factor 1 alpha 1 Calculated Molecular Weight: 462 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC014224 Gene Symbol: EEF1A1 Gene ID (NCBI): 1915 RRID: AB_2096966 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P68104 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.