Iright
BRAND / VENDOR: Proteintech

Proteintech, 11415-1-AP, LYPD1 Polyclonal antibody

CATALOG NUMBER: 11415-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LYPD1 (11415-1-AP) by Proteintech is a Polyclonal antibody targeting LYPD1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11415-1-AP targets LYPD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LY6/PLAUR domain containing 1 (LYPD1) is a highly conserved glycosylphosphatidylinositol (GPI)-anchored protein. LYPD1 contains one cysteine-rich extracellular leukocyte antigen-6 (Ly6)/uPAR (PLAUR) domain followed by signal sequence that triggers posttranslational GPI-anchor addition incorporating mature, LYPD1 into the plasma membrane. LYPD1 is believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. LYPD1 increases receptor desensitization in vitro and decreases affinity for ACh of alpha-4:beta-2-containing nAChRs. LYPD1 has 4 isoforms produced by alternative splicing (PMID: 33536191). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1965 Product name: Recombinant human LYPD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC017318 Sequence: MWVLGIAATFCGLFLLPGFALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASALRPGLRTTILFLKLALFSAHC Predict reactive species Full Name: LY6/PLAUR domain containing 1 Calculated Molecular Weight: 141 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC017318 Gene Symbol: LYPD1 Gene ID (NCBI): 116372 RRID: AB_3085372 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N2G4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924