Proteintech, 11421-1-AP, COX6A2 Polyclonal antibody

Size: 20ul / 150ul The COX6A2 (11421-1-AP) by Proteintech is a Polyclonal antibody targeting COX6A2 in IF-P, ELISA applications with reactivity to human samples 11421-1-AP targets COX6A2 in WB, IF-P, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF-P detected in: human heart tissue Recommended dilution Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information COX6A2(Cytochrome c oxidase subunit 6A2, mitochondrial) is also named as COX6A, COX6AH and Belongs to the cytochrome c oxidase subunit 6A family. This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1985 Product name: Recombinant human COX6A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC029818 Sequence: MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP Predict reactive species Full Name: cytochrome c oxidase subunit VIa polypeptide 2 Calculated Molecular Weight: 97 aa, 11 kDa GenBank Accession Number: BC029818 Gene Symbol: COX6A2 Gene ID (NCBI): 1339 RRID: AB_11232029 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02221 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.