Iright
BRAND / VENDOR: Proteintech

Proteintech, 11422-1-AP, MARCKSL1 Polyclonal antibody

CATALOG NUMBER: 11422-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MARCKSL1 (11422-1-AP) by Proteintech is a Polyclonal antibody targeting MARCKSL1 in WB, IHC, ELISA applications with reactivity to human samples 11422-1-AP targets MARCKSL1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue Positive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MARCKS-like protein 1 (MARCKSL1) is widely expressed in nervous tissue, it is also named MARCKS-like protein (MLP) or MARCKS-related protein (MRP) and belongs to the MARCKS family, which is a highly acidic myristoylated family of PKC substrates widely distributed in diverse cell types including macrophages. The protein has a calculated molecular weight of 20 kDa and an apparent molecular weight of 42-48 kDa due to anomalous migration on SDS gels or phosphorylation. Genetic disruption of MARCKSL1 results in neural tube closure defects, events that depend on coordinated control of actin functions, cell shape, and cell migration. MARCKSL1 are thought to regulate the actin cytoskeleton and thereby participate in major cellular responses such as phagocytosis, secretion, motility, mitogenesis, and membrane trafficking. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1967 Product name: Recombinant human MARCKSL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-195 aa of BC007904 Sequence: MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE Predict reactive species Full Name: MARCKS-like 1 Calculated Molecular Weight: 195 aa, 20 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC007904 Gene Symbol: MARCKSL1 Gene ID (NCBI): 65108 RRID: AB_2140456 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49006 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924