Proteintech, 11445-1-AP, RAB24 Polyclonal antibody

Size: 20ul / 150ul The RAB24 (11445-1-AP) by Proteintech is a Polyclonal antibody targeting RAB24 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11445-1-AP targets RAB24 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human skeletal muscle tissue, mouse brain tissue, fetal human brain tissue, mouse cerebellum tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking. Unlike other Rab family members, RAB24 does not interact with GDP dissociation inhibitors (GDIs), including ARHGDIA and ARHGDIB. It Interacts with ZFYVE20. Rab24 modulates several mitotic events, including chromosome segregation and cytokinesis, perhaps through the interaction with microtubules. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1995 Product name: Recombinant human RAB24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC021263 Sequence: MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH Predict reactive species Full Name: RAB24, member RAS oncogene family Calculated Molecular Weight: 203 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC021263 Gene Symbol: RAB24 Gene ID (NCBI): 53917 RRID: AB_2269046 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969Q5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.