Iright
BRAND / VENDOR: Proteintech

Proteintech, 11450-1-AP, Myozenin 2 Polyclonal antibody

CATALOG NUMBER: 11450-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Myozenin 2 (11450-1-AP) by Proteintech is a Polyclonal antibody targeting Myozenin 2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11450-1-AP targets Myozenin 2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IHC detected in: human heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MYOZ2 gene encodes for the calcineurin-binding protein myozenin-2 (or Calsarcin-1) belonging to myozenin family. Defects in MYOZ2 gene are the cause of familial hypertrophic cardiomyopathy type 16 (CMH16), a hereditary heart disorder characterized by ventricular hypertrophy. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death (PMID: 17347475). Myozenins may serve as intracellular binding proteins involved in linking Z line proteins such as alpha-actinin, and gamma-filamin. Important role in the modulation of calcineurin signaling and myofibrillogenesis of myozenin-2 have been elucidated (PMID: 11114196). Proteintech's Myozenin-2 antibody 11450-1-AP was raised against full-length protein of human origin and is able to detect band of approximate 34 kDa in Western blotting. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2008 Product name: Recombinant human MYOZ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC017402 Sequence: MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL Predict reactive species Full Name: myozenin 2 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC017402 Gene Symbol: Myozenin 2 Gene ID (NCBI): 51778 RRID: AB_2146749 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPC6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924