Iright
BRAND / VENDOR: Proteintech

Proteintech, 11452-1-AP, MIER1 Polyclonal antibody

CATALOG NUMBER: 11452-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MIER1 (11452-1-AP) by Proteintech is a Polyclonal antibody targeting MIER1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11452-1-AP targets MIER1 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, HepG2 cells, mouse heart tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2010 Product name: Recombinant human MIER1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC017423 Sequence: SADMLVHDFDDERTLEEEEMMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRY Predict reactive species Full Name: mesoderm induction early response 1 homolog (Xenopus laevis) Calculated Molecular Weight: 536 aa, 61 kDa Observed Molecular Weight: 82 kDa GenBank Accession Number: BC017423 Gene Symbol: MIER1 Gene ID (NCBI): 57708 RRID: AB_10733247 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N108 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924