Iright
BRAND / VENDOR: Proteintech

Proteintech, 11454-1-AP, MZB1 Polyclonal antibody

CATALOG NUMBER: 11454-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MZB1 (11454-1-AP) by Proteintech is a Polyclonal antibody targeting MZB1 in WB, IHC, ELISA applications with reactivity to human samples 11454-1-AP targets MZB1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: human gliomas tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information MZB1, also named as ,PACAP, MGC29506 and pERp1, belongs to the PERP1 family. It is associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. MGC29506(PACAP) may exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity. Isoform 2 may be involved in regulation of apoptosis. (PubMed: 11350957) MZB1 has 5 isoforms with MW 21kd and 7-13kd. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2015 Product name: Recombinant human MZB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC021275 Sequence: MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL Predict reactive species Full Name: hypothetical protein MGC29506 Calculated Molecular Weight: 189 aa, 21 kDa Observed Molecular Weight: 19-21 kDa GenBank Accession Number: BC021275 Gene Symbol: MZB1 Gene ID (NCBI): 51237 RRID: AB_832820 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WU39 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924