Iright
BRAND / VENDOR: Proteintech

Proteintech, 11461-1-AP, LILRA2 Polyclonal antibody

CATALOG NUMBER: 11461-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LILRA2 (11461-1-AP) by Proteintech is a Polyclonal antibody targeting LILRA2 in WB, IHC, ELISA applications with reactivity to human, pig samples 11461-1-AP targets LILRA2 in WB, IHC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: A549 cells, pig spleen tissue, HepG2 cells, THP-1 cells, human peripheral blood leukocytes Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, pig Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2003 Product name: Recombinant human LILRA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-400 aa of BC017412 Sequence: MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLS Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 Calculated Molecular Weight: 466 aa, 51 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC017412 Gene Symbol: LILRA2 Gene ID (NCBI): 11027 RRID: AB_2136370 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N149 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924