Iright
BRAND / VENDOR: Proteintech

Proteintech, 11465-1-AP, FXYD7 Polyclonal antibody

CATALOG NUMBER: 11465-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FXYD7 (11465-1-AP) by Proteintech is a Polyclonal antibody targeting FXYD7 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 11465-1-AP targets FXYD7 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information FXYD7 (FXYD domain containing ion transport regulator 7) is a single-pass membrane protein that belongs to the FXYD family. The FXYD family, which contains seven members, are tissue specific regulators of the Na,K-ATPase. Expressed exclusively in the brain, FXYD7 is an isoform-specific Na,K-ATPase regulator which could play an important role in neuronal excitability. It has been reported that FXYD7 bears post-translationally added modifications on threonine residues and has an apparent molecular weight of 18 kDa (PMID: 12093728). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2030 Product name: Recombinant human FXYD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC018619 Sequence: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV Predict reactive species Full Name: FXYD domain containing ion transport regulator 7 Calculated Molecular Weight: 9 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC018619 Gene Symbol: FXYD7 Gene ID (NCBI): 53822 RRID: AB_2108627 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58549 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924