Proteintech, 11466-1-AP, RAX2 Polyclonal antibody

Size: 20ul / 150ul The RAX2 (11466-1-AP) by Proteintech is a Polyclonal antibody targeting RAX2 in WB, ELISA applications with reactivity to human samples 11466-1-AP targets RAX2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2046 Product name: Recombinant human RAX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC018709 Sequence: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA Predict reactive species Full Name: retina and anterior neural fold homeobox 2 Calculated Molecular Weight: 184 aa, 20 kDa Observed Molecular Weight: 22-27 kDa GenBank Accession Number: BC018709 Gene Symbol: RAX2 Gene ID (NCBI): 84839 RRID: AB_2877764 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96IS3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.