Iright
BRAND / VENDOR: Proteintech

Proteintech, 11487-1-AP, HECTD3 Polyclonal antibody

CATALOG NUMBER: 11487-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HECTD3 (11487-1-AP) by Proteintech is a Polyclonal antibody targeting HECTD3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 11487-1-AP targets HECTD3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, MDA-MB-453s cells Positive IP detected in: MDA-MB-453s cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information HECTD3(HECT domain-containing protein 3) may be involved in the regulation of mitotic metaphase/anaphase transition. It can specifically ubiquitinate TRIOBP and target it for proteasomal degradation and it can also mediates the ubiquitination of STX8. HECTD3 is a new oncogenic E3 ligase in human prostate cancer.( Li Y, etc. 2008) HECTD3 may facilitate cell cycle progression via regulating ubiquitination and degradation of Tara(PMID:18194665). It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1998 Product name: Recombinant human HECTD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-213 aa of BC019105 Sequence: VMEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNFTNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEKLRYAAYNCVAIDTDMSPWEE Predict reactive species Full Name: HECT domain containing 3 Calculated Molecular Weight: 861 aa, 97 kDa Observed Molecular Weight: 97 kDa GenBank Accession Number: BC019105 Gene Symbol: HECTD3 Gene ID (NCBI): 79654 RRID: AB_2117517 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T447 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924