Proteintech, 11502-1-AP, SP110 Polyclonal antibody

Size: 20ul / 150ul The SP110 (11502-1-AP) by Proteintech is a Polyclonal antibody targeting SP110 in WB, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 11502-1-AP targets SP110 in WB, FC (Intra), IP, ELISA, IF applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A2780 cells, PC-3 cells, human brain tissue, Jurkat cells, K-562 cells, human testis tissue, HeLa cells, COLO 320 cells. Positive IP detected in: HeLa cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2042 Product name: Recombinant human SP110 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC019059 Sequence: MFTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMESLEACRNLIPVSRVVHNILTQLERTFNLSLLVTLFSQINLREYPNLVTIYRSFKRVGASYERQSRDTPILLEAPTGLAEGSSLHTPLALPPPQPPQPSCSPCAPRVSEPGTSSQQSDEILSESPSPSDPVLPLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSDKKGKKRKRCIWSTPKRRHKKKSLPRALSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEII Predict reactive species Full Name: SP110 nuclear body protein Calculated Molecular Weight: 689 aa, 79 kDa Observed Molecular Weight: 62-66 kDa GenBank Accession Number: BC019059 Gene Symbol: SP110 Gene ID (NCBI): 3431 RRID: AB_10863116 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HB58 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.