Proteintech, 11513-1-AP, PHF15 Polyclonal antibody

Size: 20ul / 150ul The PHF15 (11513-1-AP) by Proteintech is a Polyclonal antibody targeting PHF15 in WB, ELISA applications with reactivity to human, Canine samples 11513-1-AP targets PHF15 in WB, IHC, IF, ELISA applications and shows reactivity with human, Canine samples. Tested Applications Positive WB detected in: MDCK cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, Canine Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2073 Product name: Recombinant human PHF15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC021962 Sequence: MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPSEVFRTDLITAMKIPDSYQLSPDDYYILADPWRQEWEKGVQVPAGAEAIPEPVVRILPPLEGPPAQASPSSTMLGEGSQPDWPGGSRYDLDEIDAYWLELINSELKEMERPELDELTLERVLEELETLCHQNMARAIETQEGLGIEYDEDVVCDVCRSPEGEDGNEMVFCDKCNVCVHQACYGILKVPTGSWLCRTCALGVQPKCLLCPKRGGALKPTRSGTKWVHVSCALWIPEVSIGCPEKMEPITKIS Predict reactive species Full Name: PHD finger protein 15 Calculated Molecular Weight: 791 aa, 88 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC021962 Gene Symbol: PHF15 Gene ID (NCBI): 23338 RRID: AB_2877772 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQC1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.