Proteintech, 11530-1-AP, CCDC28B Polyclonal antibody

Size: 20ul / 150ul The CCDC28B (11530-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC28B in WB, ELISA applications with reactivity to human, mouse, rat samples 11530-1-AP targets CCDC28B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2105 Product name: Recombinant human CCDC28B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC022848 Sequence: MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGSGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA Predict reactive species Full Name: coiled-coil domain containing 28B Calculated Molecular Weight: 200 aa, 22 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC022848 Gene Symbol: CCDC28B Gene ID (NCBI): 79140 RRID: AB_2072070 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUN5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.