Proteintech, 11549-1-AP, CAMKK2 Polyclonal antibody

Size: 20ul / 150ul The CAMKK2 (11549-1-AP) by Proteintech is a Polyclonal antibody targeting CAMKK2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 11549-1-AP targets CAMKK2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, fetal human brain tissue, HeLa cells, PC-3 cells, RAW 264.7 cells Positive IP detected in: PC-3 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CAMKK2(calcium/calmodulin-dependent protein kinase kinase 2) is also named as CAMKKB, KIAA0787 and belongs to the protein kinase superfamily. It regulates hypothalamic production of the orexigenic hormone NPY and contributes to the regulation of energy balance. CAMKK2 in vivo reduces tumor growth suggests that reactivation of CAMKK2 by development of new drugs may be a new strategy to prolong the period to respond androgen-deprivation therapy(ADT)(PMID:22549914). It can be autophosphorylated(PMID:19369195). It has 7 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, monkey, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2093 Product name: Recombinant human CAMKK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC026060 Sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAF Predict reactive species Full Name: calcium/calmodulin-dependent protein kinase kinase 2, beta Calculated Molecular Weight: 588 aa, 60 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC026060 Gene Symbol: CAMKK2 Gene ID (NCBI): 10645 RRID: AB_2259441 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RR4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.