Iright
BRAND / VENDOR: Proteintech

Proteintech, 11550-1-AP, MEIS2 Polyclonal antibody

CATALOG NUMBER: 11550-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MEIS2 (11550-1-AP) by Proteintech is a Polyclonal antibody targeting MEIS2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11550-1-AP targets MEIS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, PC-3 cells, A549 cells, LNCaP cells, HCT 116 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information MEIS2, also named as Meis1-related protein 1 or MRG1, is a 477 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the TALE/MEIS homeobox family. MEIS2 is expressed in various tissues and at high level in the lymphoid organs of hematopoietic tissues. MEIS2 localizes in the nucleus and is involved in transcriptional regulation. MEIS2 is a critical downstream effector within an essential homeoprotein network that serving a rate-limiting regulatory role in MLL leukemogenesis. MEIS2 as midbrain specific marker is upregulated concomitantly with the morphological transformation of hindbrain to midbrain. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2096 Product name: Recombinant human MEIS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-381 aa of BC001516 Sequence: MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM Predict reactive species Full Name: Meis homeobox 2 Calculated Molecular Weight: 381 aa, 42 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC001516 Gene Symbol: MEIS2 Gene ID (NCBI): 4212 RRID: AB_2143028 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14770 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924