Proteintech, 11584-1-AP, PNKD Polyclonal antibody

Size: 20ul / 150ul The PNKD (11584-1-AP) by Proteintech is a Polyclonal antibody targeting PNKD in IHC, ELISA applications with reactivity to human, mouse, rat samples 11584-1-AP targets PNKD in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human prostate cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2176 Product name: Recombinant human PNKD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC021118 Sequence: MAAVVAATALKGRGARNARVLRGILAGATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKAVGLAWAIGFPCGILLFILTKREVDKDRVKQMKARQNMRLSNTGEYESQRFRASSQSAPSPDVGSGVQT Predict reactive species Full Name: paroxysmal nonkinesigenic dyskinesia Calculated Molecular Weight: 385 aa, 43 kDa GenBank Accession Number: BC021118 Gene Symbol: PNKD Gene ID (NCBI): 25953 RRID: AB_2877780 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N490 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.