Iright
BRAND / VENDOR: Proteintech

Proteintech, 11589-1-AP, BRSK2 Polyclonal antibody

CATALOG NUMBER: 11589-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BRSK2 (11589-1-AP) by Proteintech is a Polyclonal antibody targeting BRSK2 in WB, ELISA applications with reactivity to human, mouse, rat samples 11589-1-AP targets BRSK2 in WB, IP, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse testis tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information BRSK2 is highly conserved from invertebrates to human, plays a key role in polarization of neurons and has been identified with different names: SAD1 is its closest homolog in C. elegans, serine/threonine kinase SADA alfa in rat, brain-selective kinase 2 and SAD-B in mouse and hsSAD1 and SAD1B in humans(PMID:16165222) . In rat and mouse, BRSK2 is only detected in the brain and at low levels in the testis .It has some isoforms produced by alternative splicing with the molecular mass of 68-84 kDa. This protein has a conserved function throughout the evolution. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2195 Product name: Recombinant human BRSK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC024291 Sequence: MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL Predict reactive species Full Name: BR serine/threonine kinase 2 Calculated Molecular Weight: 87 kDa Observed Molecular Weight: 80-88 kDa GenBank Accession Number: BC024291 Gene Symbol: BRSK2 Gene ID (NCBI): 9024 RRID: AB_2243660 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWQ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924