Iright
BRAND / VENDOR: Proteintech

Proteintech, 11613-1-AP, BCL11A Polyclonal antibody

CATALOG NUMBER: 11613-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BCL11A (11613-1-AP) by Proteintech is a Polyclonal antibody targeting BCL11A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11613-1-AP targets BCL11A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Daudi cells Positive IHC detected in: human tonsillitis tissue, human gliomas tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information B-CELL CLL/LYMPHOMA 11A(BCL11A)is a highly conserved zinc finger gene. It acts as a myeloid and B-cell proto-oncogene, and may play key roles in leukemogenesis and hematopoiesis. It is an essential factor in lymphopoiesis, and required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1. It is also involved in lymphoid malignancies through translocation or amplification events. It has recently been shown that BCL11A expression is inversely correlated with γ globin expression.(PMID:21156846). This is a rabbit polyclonal antibody raised against part chain of N-terminal BCL11A of human origin. There are three isoforms of BCL11A: isoform1(773aa), isoform2(486aa) and isoform3(239aa) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2187 Product name: Recombinant human BCL11A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC021098 Sequence: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPRVGIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGSK Predict reactive species Full Name: B-cell CLL/lymphoma 11A (zinc finger protein) Calculated Molecular Weight: 835 aa, 91 kDa GenBank Accession Number: BC021098 Gene Symbol: BCL11A Gene ID (NCBI): 53335 RRID: AB_2259028 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H165 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924