Proteintech, 11617-1-AP, DDX28 Polyclonal antibody

Size: 20ul / 150ul The DDX28 (11617-1-AP) by Proteintech is a Polyclonal antibody targeting DDX28 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11617-1-AP targets DDX28 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2194 Product name: Recombinant human DDX28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 191-540 aa of BC024273 Sequence: LGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQLSRQPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADKVAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 Calculated Molecular Weight: 540 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC024273 Gene Symbol: DDX28 Gene ID (NCBI): 55794 RRID: AB_2092574 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NUL7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.