Proteintech, 11620-1-AP, FTSJ1 Polyclonal antibody

Size: 20ul / 150ul The FTSJ1 (11620-1-AP) by Proteintech is a Polyclonal antibody targeting FTSJ1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11620-1-AP targets FTSJ1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, U-87 MG cells Positive IHC detected in: human liver tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2199 Product name: Recombinant human FTSJ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC023584 Sequence: MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP Predict reactive species Full Name: FtsJ homolog 1 (E. coli) Calculated Molecular Weight: 329 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC023584 Gene Symbol: FTSJ1 Gene ID (NCBI): 24140 RRID: AB_2877785 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UET6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.