Proteintech, 11645-1-AP, KLC3 Polyclonal antibody

Size: 20ul / 150ul The KLC3 (11645-1-AP) by Proteintech is a Polyclonal antibody targeting KLC3 in WB, ELISA applications with reactivity to human, mouse, rat samples 11645-1-AP targets KLC3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, human liver tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2243 Product name: Recombinant human KLC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC025318 Sequence: MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQLEEEKRHLEFLGQLRQYDPPAESQVPRAGRGGGCWALHRAPQSPRPSLESHSPQDPP Predict reactive species Full Name: kinesin light chain 3 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC025318 Gene Symbol: KLC3 Gene ID (NCBI): 147700 RRID: AB_2132090 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P597 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.