Proteintech, 11664-1-AP, PPP1R7 Polyclonal antibody

Size: 20ul / 150ul The PPP1R7 (11664-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R7 in WB, ELISA applications with reactivity to human, mouse samples 11664-1-AP targets PPP1R7 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, mouse brain tissue, mouse liver tissue, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2263 Product name: Recombinant human PPP1R7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-360 aa of BC000910 Sequence: MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 7 Calculated Molecular Weight: 360 aa, 40 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC000910 Gene Symbol: PPP1R7 Gene ID (NCBI): 5510 RRID: AB_10598313 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15435 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.