Iright
BRAND / VENDOR: Proteintech

Proteintech, 11667-1-AP, NFATC2IP Polyclonal antibody

CATALOG NUMBER: 11667-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NFATC2IP (11667-1-AP) by Proteintech is a Polyclonal antibody targeting NFATC2IP in WB, IF/ICC, ELISA applications with reactivity to human samples 11667-1-AP targets NFATC2IP in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, Raji cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NFATC2IP, also named as NIP45, is a 419 amino acid protein, which contains one ubiquitin-like domain. TRAF1 is associated with a fraction of NFATC2IP in the cytoplasm and prevents its translocation to the nucleus. NFATC2IP In T-helper 2 (Th2) cells, regulates the magnitude of NFAT-driven transcription of a specific subset of cytokine genes, including IL3, IL4, IL5 and IL13, but not IL2. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2217 Product name: Recombinant human NFATC2IP protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-218 aa of BC021551 Sequence: PPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG Predict reactive species Full Name: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein Calculated Molecular Weight: 138 aa, 15 kDa Observed Molecular Weight: 50-65 kDa GenBank Accession Number: BC021551 Gene Symbol: NFATC2IP Gene ID (NCBI): 84901 RRID: AB_3669129 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NCF5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924