Proteintech, 11670-1-AP, SSX1 Polyclonal antibody

Size: 20ul / 150ul The SSX1 (11670-1-AP) by Proteintech is a Polyclonal antibody targeting SSX1 in WB, ELISA applications with reactivity to human samples 11670-1-AP targets SSX1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2254 Product name: Recombinant human SSX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-188 aa of BC001003 Sequence: MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE Predict reactive species Full Name: synovial sarcoma, X breakpoint 1 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 21-25 kDa GenBank Accession Number: BC001003 Gene Symbol: SSX1 Gene ID (NCBI): 6756 RRID: AB_2877788 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16384 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.